Lineage for d3w4yb_ (3w4y B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263825Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 1263854Family a.24.15.0: automated matches [191449] (1 protein)
    not a true family
  6. 1263855Protein automated matches [190684] (3 species)
    not a true protein
  7. 1263859Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194765] (2 PDB entries)
  8. 1263862Domain d3w4yb_: 3w4y B: [201271]
    automated match to d3w4yc_
    complexed with fad

Details for d3w4yb_

PDB Entry: 3w4y (more details), 2 Å

PDB Description: Crystal structure of yeast Erv1 core
PDB Compounds: (B:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d3w4yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w4yb_ a.24.15.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
shmpgsrtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypc
nwcakdfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

SCOPe Domain Coordinates for d3w4yb_:

Click to download the PDB-style file with coordinates for d3w4yb_.
(The format of our PDB-style files is described here.)

Timeline for d3w4yb_: