| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
| Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
| Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries) |
| Domain d3vzlc_: 3vzl C: [201264] automated match to d3vzlb_ complexed with so4; mutant |
PDB Entry: 3vzl (more details), 2 Å
SCOPe Domain Sequences for d3vzlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vzlc_ b.29.1.11 (C:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntghfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw
Timeline for d3vzlc_: