Lineage for d3vzkb_ (3vzk B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389728Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2389773Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2389796Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)
  8. 2389798Domain d3vzkb_: 3vzk B: [201262]
    automated match to d3vzka_
    complexed with so4; mutant

Details for d3vzkb_

PDB Entry: 3vzk (more details), 1.55 Å

PDB Description: Crystal structure of the Bacillus circulans endo-beta-(1,4)-xylanase (BcX) N35E mutant
PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3vzkb_:

Sequence, based on SEQRES records: (download)

>d3vzkb_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgefvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Sequence, based on observed residues (ATOM records): (download)

>d3vzkb_ b.29.1.11 (B:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtdgggivnavngsggnysvnwsntgefvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsitt
ftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgssnvtv
w

SCOPe Domain Coordinates for d3vzkb_:

Click to download the PDB-style file with coordinates for d3vzkb_.
(The format of our PDB-style files is described here.)

Timeline for d3vzkb_: