SCOPe 2.08: Domain d3vw9a_: 3vw9 A:

Lineage for d3vw9a_ (3vw9 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (2 proteins)
   duplication: consists of two clear structural repeats each having this fold

6. Protein automated matches [190953] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193319] (3 PDB entries)

8. Domain d3vw9a_: 3vw9 A: [201258]
   automated match to d3vw9b_
   complexed with epe, hpj, zn

Details for d3vw9a_

PDB Entry: 3vw9, 1.47 Å

PDB Description: Human Glyoxalase I with an N-hydroxypyridone inhibitor

PDB Compounds: (A:) lactoylglutathione lyase

SCOPe Domain Sequences for d3vw9a_:

Sequence; same for both SEQRES and ATOM records:

>d3vw9a_ d.32.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm

Timeline for d3vw9a_:

• d3vw9a_ first appeared in SCOPe 2.03
  
• d3vw9a_ appears in SCOPe 2.07