SCOPe 2.05: Domain d3vttb_: 3vtt B:

Lineage for d3vttb_ (3vtt B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Dengue virus type 3 [TaxId:408870] [193303] (1 PDB entry)

8. Domain d3vttb_: 3vtt B: [201256]
   automated match to d3vtta_
   complexed with so4

Details for d3vttb_

PDB Entry: 3vtt, 1.7 Å

PDB Description: High Resolution crystal structure of Dengue 3 Envelope protein domain III (ED3)

PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d3vttb_:

Sequence; same for both SEQRES and ATOM records:

>d3vttb_ b.1.18.0 (B:) automated matches {Dengue virus type 3 [TaxId: 408870]}
msyamclntfvlkkevsetqhgtilikveykgedapckipfstedgqgkahngrlitanp
vvtkkeepvnieaeppfgesnivigigdkalkinwyrkgssigk

Timeline for d3vttb_:

• d3vttb_ first appeared in SCOPe 2.03
  
• d3vttb_ appears in SCOPe 2.04
  
• d3vttb_ appears in SCOPe 2.06
  
• d3vttb_ appears in the current release, SCOPe 2.08