SCOPe 2.07: Domain d3voeb_: 3voe B:

Lineage for d3voeb_ (3voe B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein automated matches [190294] (6 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [193218] (4 PDB entries)

8. Domain d3voeb_: 3voe B: [201250]
   automated match to d3voea_

Details for d3voeb_

PDB Entry: 3voe, 2.6 Å

PDB Description: Crystal Structure of wild type MarR (apo form) from E.coli

PDB Compounds: (B:) multiple antibiotic resistance protein marr

SCOPe Domain Sequences for d3voeb_:

Sequence; same for both SEQRES and ATOM records:

>d3voeb_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
eiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvelkkvlsvdlg
altrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlhqeltknlta
devatleyllkkvlp

Timeline for d3voeb_:

• d3voeb_ first appeared in SCOPe 2.03
  
• d3voeb_ appears in SCOPe 2.06