Lineage for d3voeb_ (3voe B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693816Protein automated matches [190294] (6 species)
    not a true protein
  7. 2693821Species Escherichia coli K-12 [TaxId:83333] [193218] (4 PDB entries)
  8. 2693825Domain d3voeb_: 3voe B: [201250]
    automated match to d3voea_

Details for d3voeb_

PDB Entry: 3voe (more details), 2.6 Å

PDB Description: Crystal Structure of wild type MarR (apo form) from E.coli
PDB Compounds: (B:) multiple antibiotic resistance protein marr

SCOPe Domain Sequences for d3voeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3voeb_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
eiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvelkkvlsvdlg
altrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlhqeltknlta
devatleyllkkvlp

SCOPe Domain Coordinates for d3voeb_:

Click to download the PDB-style file with coordinates for d3voeb_.
(The format of our PDB-style files is described here.)

Timeline for d3voeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3voea_