![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein automated matches [190294] (6 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [193218] (4 PDB entries) |
![]() | Domain d3voeb_: 3voe B: [201250] automated match to d3voea_ |
PDB Entry: 3voe (more details), 2.6 Å
SCOPe Domain Sequences for d3voeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3voeb_ a.4.5.28 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} eiiplgrlihmvnqkkdrllneylsplditaaqfkvlcsircaacitpvelkkvlsvdlg altrmldrlvckgwverlpnpndkrgvlvklttggaaiceqchqlvgqdlhqeltknlta devatleyllkkvlp
Timeline for d3voeb_: