Lineage for d1ad0b1 (1ad0 B:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 450917Species Engineered (including hybrid species) [88562] (31 PDB entries)
  8. 450938Domain d1ad0b1: 1ad0 B:1-113 [20125]
    Other proteins in same PDB: d1ad0a1, d1ad0a2, d1ad0b2, d1ad0c1, d1ad0c2, d1ad0d2

Details for d1ad0b1

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

SCOP Domain Sequences for d1ad0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqllesggglvqpggslrlscatsgftftdyymnwvrqapgkglewlgfignkangytt
eysasvkgrftisrdkskstlylqmntlqaedsaiyyctrdrglrfyfdywgqgtlvtvs
s

SCOP Domain Coordinates for d1ad0b1:

Click to download the PDB-style file with coordinates for d1ad0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ad0b1: