Lineage for d1ad0a1 (1ad0 A:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219538Species Fab A5B7 (engineered human construct), kappa L chain [48823] (1 PDB entry)
  8. 219539Domain d1ad0a1: 1ad0 A:1-107 [20124]
    Other proteins in same PDB: d1ad0a2, d1ad0b2, d1ad0c2, d1ad0d2

Details for d1ad0a1

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

SCOP Domain Sequences for d1ad0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab A5B7 (engineered human construct), kappa L chain}
qtvltqspsslsvsvgdrvtitcrasssvtyihwyqqkpglapksliyatsnlasgvpsr
fsgsgsgtdytftisslqpediatyycqhwsskpptfgqgtkvevkr

SCOP Domain Coordinates for d1ad0a1:

Click to download the PDB-style file with coordinates for d1ad0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ad0a1: