Lineage for d3vicb_ (3vic B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407412Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1407645Protein automated matches [190406] (14 species)
    not a true protein
  7. 1407759Species Coral (Montipora efflorescens) [TaxId:105610] [188535] (3 PDB entries)
  8. 1407769Domain d3vicb_: 3vic B: [201238]
    automated match to d3vicc_
    complexed with cl, iod

Details for d3vicb_

PDB Entry: 3vic (more details), 2.2 Å

PDB Description: green-fluorescent variant of the non-fluorescent chromoprotein rtms5
PDB Compounds: (B:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d3vicb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vicb_ d.22.1.1 (B:) automated matches {Coral (Montipora efflorescens) [TaxId: 105610]}
msviatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspq
cxsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkfsg
lnfppngpvmqkktqgwephserlfarggmlignnfmalkleggghylcefkttykakkp
vkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

SCOPe Domain Coordinates for d3vicb_:

Click to download the PDB-style file with coordinates for d3vicb_.
(The format of our PDB-style files is described here.)

Timeline for d3vicb_: