SCOPe 2.06: Domain d3vdpd_: 3vdp D:

Lineage for d3vdpd_ (3vdp D:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.49: Recombination protein RecR [111303] (1 superfamily)
   consists of three domains: alpha-helical dimerisation domain (res. 1-53) with HhH motif; 'treble cleft' C4 zinc-finger domain (54-76); and Toprim domain (76-199; segment-swapped dimer)

4. Superfamily e.49.1: Recombination protein RecR [111304] (1 family)

5. Family e.49.1.1: Recombination protein RecR [111305] (1 protein)
   three sequential domains correspond to Pfam PF00633, Pfam PF02132 and Pfam PF01751, respectively

6. Protein Recombination protein RecR [111306] (2 species)

7. Species Thermoanaerobacter tengcongensis [TaxId:273068] [193312] (4 PDB entries)

8. Domain d3vdpd_: 3vdp D: [201234]
   automated match to d3vdpb_
   complexed with imd, zn

Details for d3vdpd_

PDB Entry: 3vdp, 2.45 Å

PDB Description: Structure and biochemical studies of the recombination mediator protein RecR in RecFOR pathway

PDB Compounds: (D:) recombination protein recr

SCOPe Domain Sequences for d3vdpd_:

Sequence; same for both SEQRES and ATOM records:

>d3vdpd_ e.49.1.1 (D:) Recombination protein RecR {Thermoanaerobacter tengcongensis [TaxId: 273068]}
msyystsvaklieelsklpgigpktaqrlaffiinmpldevrslsqaiieakeklrycki
cfnitdkevcdicsdenrdhsticvvshpmdvvamekvkeykgvyhvlhgvispiegvgp
edirikellervrdgsvkevilatnpdiegeatamyiakllkpfgvkvtriahgipvggd
leytdvvtlskalegrrev

Timeline for d3vdpd_:

• d3vdpd_ first appeared in SCOPe 2.03
  
• d3vdpd_ appears in SCOPe 2.05
  
• d3vdpd_ appears in SCOPe 2.07
  
• d3vdpd_ appears in the current release, SCOPe 2.08