Lineage for d1cloh1 (1clo H:1-113)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021842Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2021881Domain d1cloh1: 1clo H:1-113 [20123]
    Other proteins in same PDB: d1cloh2, d1clol1, d1clol2
    part of Fab A5B7

Details for d1cloh1

PDB Entry: 1clo (more details), 2.1 Å

PDB Description: anti-carcinoembryonic antigen monoclonal antibody a5b7
PDB Compounds: (H:) a5b7 monoclonal antibody

SCOPe Domain Sequences for d1cloh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cloh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqpggslrlscatsgftftdyymnwvrqppgkalewlgfignkangytt
eysasvkgrftisrdksqsilylqmntlraedsatyyctrdrglrfyfdywgqgttltvs
s

SCOPe Domain Coordinates for d1cloh1:

Click to download the PDB-style file with coordinates for d1cloh1.
(The format of our PDB-style files is described here.)

Timeline for d1cloh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cloh2