SCOP 1.63: Domain d1cloh1: 1clo H:1-113

Lineage for d1cloh1 (1clo H:1-113)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab A5B7 (mouse), kappa L chain [48822] (1 PDB entry)

8. Domain d1cloh1: 1clo H:1-113 [20123]
   Other proteins in same PDB: d1cloh2, d1clol2

Details for d1cloh1

PDB Entry: 1clo, 2.1 Å

PDB Description: anti-carcinoembryonic antigen monoclonal antibody a5b7

SCOP Domain Sequences for d1cloh1:

Sequence; same for both SEQRES and ATOM records:

>d1cloh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab A5B7 (mouse), kappa L chain}
evklvesggglvqpggslrlscatsgftftdyymnwvrqppgkalewlgfignkangytt
eysasvkgrftisrdksqsilylqmntlraedsatyyctrdrglrfyfdywgqgttltvs
s

Timeline for d1cloh1:

• d1cloh1 first appeared (with stable ids) in SCOP 1.55
  
• d1cloh1 appears in SCOP 1.61
  
• d1cloh1 appears in SCOP 1.65
  
• d1cloh1 appears in the current release, SCOPe 2.08