SCOPe 2.05: Domain d3vd1c_: 3vd1 C:

Lineage for d3vd1c_ (3vd1 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186941] (47 PDB entries)

8. Domain d3vd1c_: 3vd1 C: [201227]
   automated match to d3vd1k_
   protein/DNA complex; complexed with zn

Details for d3vd1c_

PDB Entry: 3vd1, 2.95 Å

PDB Description: structure of p73 DNA binding domain tetramer modulates p73 transactivation

PDB Compounds: (C:) Tumor protein p73

SCOPe Domain Sequences for d3vd1c_:

Sequence; same for both SEQRES and ATOM records:

>d3vd1c_ b.2.5.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hefipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstpppp
gtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvt
grqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfe
gricacpgrdrkadedhyreq

Timeline for d3vd1c_:

• d3vd1c_ first appeared in SCOPe 2.03
  
• d3vd1c_ appears in SCOPe 2.04
  
• d3vd1c_ is called d3vd1c1 in SCOPe 2.06
  
• d3vd1c_ appears in the current release, SCOPe 2.08, called d3vd1c1