Lineage for d3vcyb_ (3vcy B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2563818Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) (S)
  5. 2563828Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
    automatically mapped to Pfam PF00275
  6. 2563960Protein automated matches [190917] (11 species)
    not a true protein
  7. 2564029Species Vibrio fischeri [TaxId:388396] [195595] (1 PDB entry)
  8. 2564031Domain d3vcyb_: 3vcy B: [201223]
    automated match to d3vcyc_
    complexed with ffq, gol, po4, ud1

Details for d3vcyb_

PDB Entry: 3vcy (more details), 1.93 Å

PDB Description: Structure of MurA (UDP-N-acetylglucosamine enolpyruvyl transferase), from Vibrio fischeri in complex with substrate UDP-N-acetylglucosamine and the drug fosfomycin.
PDB Compounds: (B:) UDP-N-acetylglucosamine 1-carboxyvinyltransferase

SCOPe Domain Sequences for d3vcyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vcyb_ d.68.2.2 (B:) automated matches {Vibrio fischeri [TaxId: 388396]}
mdkfriqgsdkplsgevtisgaknaalpilfasllaeepvevanvpklrdvdttmellkr
lgaevsrngsvhidasgvndfcapydlvktmrasiwalgplvarfgkgqvslpggcaiga
rpvdlhihgleqlgatikleegyvkaevdgrlkgahivmdkvsvgatitvmcaatlaegt
tvlenaarepeivdtanflnaigakvsgmgtdtitiegverlgggyhevvadrietgtfl
vaaavsggkivckntkahlleavlakleeagadvqtgddwisldmtgrelkavnirtaph
pafptdmqaqftllnmmakgsgiitetifenrfmhipelqrmgahaeiegntaicgdtdg
lsgaqvmatdlrasaslviagciakgetivdriyhidrgydkiedkltalganiervhs

SCOPe Domain Coordinates for d3vcyb_:

Click to download the PDB-style file with coordinates for d3vcyb_.
(The format of our PDB-style files is described here.)

Timeline for d3vcyb_: