![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.68: IF3-like [55199] (8 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.2: EPT/RTPC-like [55205] (3 families) ![]() |
![]() | Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (3 proteins) duplication: 6 repeats of this fold are organized in two RPTC-like domains automatically mapped to Pfam PF00275 |
![]() | Protein automated matches [190917] (11 species) not a true protein |
![]() | Species Vibrio fischeri [TaxId:388396] [195595] (1 PDB entry) |
![]() | Domain d3vcyb_: 3vcy B: [201223] automated match to d3vcyc_ complexed with ffq, gol, po4, ud1 |
PDB Entry: 3vcy (more details), 1.93 Å
SCOPe Domain Sequences for d3vcyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vcyb_ d.68.2.2 (B:) automated matches {Vibrio fischeri [TaxId: 388396]} mdkfriqgsdkplsgevtisgaknaalpilfasllaeepvevanvpklrdvdttmellkr lgaevsrngsvhidasgvndfcapydlvktmrasiwalgplvarfgkgqvslpggcaiga rpvdlhihgleqlgatikleegyvkaevdgrlkgahivmdkvsvgatitvmcaatlaegt tvlenaarepeivdtanflnaigakvsgmgtdtitiegverlgggyhevvadrietgtfl vaaavsggkivckntkahlleavlakleeagadvqtgddwisldmtgrelkavnirtaph pafptdmqaqftllnmmakgsgiitetifenrfmhipelqrmgahaeiegntaicgdtdg lsgaqvmatdlrasaslviagciakgetivdriyhidrgydkiedkltalganiervhs
Timeline for d3vcyb_: