Lineage for d3vbza_ (3vbz A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1282888Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1282889Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1283411Family a.133.1.0: automated matches [194891] (1 protein)
    not a true family
  6. 1283412Protein automated matches [194892] (2 species)
    not a true protein
  7. 1283417Species Oxyuranus scutellatus [TaxId:8667] [194893] (2 PDB entries)
  8. 1283418Domain d3vbza_: 3vbz A: [201220]
    automated match to d3vbzb_

Details for d3vbza_

PDB Entry: 3vbz (more details), 1.76 Å

PDB Description: Crystal structure of Taipoxin beta subunit isoform 2
PDB Compounds: (A:) Phospholipase A2 homolog, taipoxin beta chain

SCOPe Domain Sequences for d3vbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbza_ a.133.1.0 (A:) automated matches {Oxyuranus scutellatus [TaxId: 8667]}
nlvqfgfmiecairnrrpaldfmnygcycgtvgrgtpvddldrccqvhdecyataekhgc
ypslttyqwecrqvgnecnsktqcevfvcacdlaaakclaqedynpahfnintgerck

SCOPe Domain Coordinates for d3vbza_:

Click to download the PDB-style file with coordinates for d3vbza_.
(The format of our PDB-style files is described here.)

Timeline for d3vbza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3vbzb_