SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3vbae_ (3vba E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097883Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2097920Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 2097962Family c.8.2.0: automated matches [191540] (1 protein)
    not a true family
  6. 2097963Protein automated matches [190925] (2 species)
    not a true protein
  7. 2097964Species Methanocaldococcus jannaschii [TaxId:243232] [188422] (2 PDB entries)
  8. 2097969Domain d3vbae_: 3vba E: [201217]
    Other proteins in same PDB: d3vbaa2, d3vbab2
    automated match to d3vbaf_

Details for d3vbae_

PDB Entry: 3vba (more details), 2 Å

PDB Description: Crystal structure of methanogen 3-isopropylmalate isomerase small subunit
PDB Compounds: (E:) Isopropylmalate/citramalate isomerase small subunit

SCOPe Domain Sequences for d3vbae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbae_ c.8.2.0 (E:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkma

SCOPe Domain Coordinates for d3vbae_:

Click to download the PDB-style file with coordinates for d3vbae_.
(The format of our PDB-style files is described here.)

Timeline for d3vbae_: