Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) contains mixed beta-sheet barrel, closed n=7, S=10 |
Family c.8.2.0: automated matches [191540] (1 protein) not a true family |
Protein automated matches [190925] (2 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:243232] [188422] (2 PDB entries) |
Domain d3vbad_: 3vba D: [201216] Other proteins in same PDB: d3vbaa2, d3vbab2 automated match to d3vbaf_ |
PDB Entry: 3vba (more details), 2 Å
SCOPe Domain Sequences for d3vbad_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vbad_ c.8.2.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel evnletgeiknlttgevlkgqklpefmmeileagglmpylkkk
Timeline for d3vbad_: