Lineage for d3vbac_ (3vba C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834037Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1834070Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) (S)
    contains mixed beta-sheet barrel, closed n=7, S=10
  5. 1834112Family c.8.2.0: automated matches [191540] (1 protein)
    not a true family
  6. 1834113Protein automated matches [190925] (2 species)
    not a true protein
  7. 1834114Species Methanocaldococcus jannaschii [TaxId:243232] [188422] (2 PDB entries)
  8. 1834117Domain d3vbac_: 3vba C: [201215]
    automated match to d3vbaf_

Details for d3vbac_

PDB Entry: 3vba (more details), 2 Å

PDB Description: Crystal structure of methanogen 3-isopropylmalate isomerase small subunit
PDB Compounds: (C:) Isopropylmalate/citramalate isomerase small subunit

SCOPe Domain Sequences for d3vbac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vbac_ c.8.2.0 (C:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mrsiikgrvwkfgnnvdtdailparylvytkpeelaqfvmtgadpdfpkkvkpgdiivgg
knfgcgssrehaplglkgagiscviaesfarifyrnainvglplieckgisekvnegdel
evnletgeiknlttgevlkgqklpefmmeileagglmpylkkkmae

SCOPe Domain Coordinates for d3vbac_:

Click to download the PDB-style file with coordinates for d3vbac_.
(The format of our PDB-style files is described here.)

Timeline for d3vbac_: