Lineage for d3v6ea_ (3v6e A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497848Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 protein domains)
    Pfam PF00443
  6. 2497901Protein automated matches [191167] (1 species)
    not a true protein
  7. 2497902Species Human (Homo sapiens) [TaxId:9606] [189384] (5 PDB entries)
  8. 2497905Domain d3v6ea_: 3v6e A: [201203]
    Other proteins in same PDB: d3v6eb1, d3v6eb2
    automated match to d2ibia1
    complexed with cl, gol, zn; mutant

Details for d3v6ea_

PDB Entry: 3v6e (more details), 2.1 Å

PDB Description: crystal structure of usp2 and a mutant form of ubiquitin
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 2

SCOPe Domain Sequences for d3v6ea_:

Sequence, based on SEQRES records: (download)

>d3v6ea_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpks
npenldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdls
lpiakrgypevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhl
krfsesrirtsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytayc
rspgtgewhtfndssvtpmsssqvrtsdayllfyela

Sequence, based on observed residues (ATOM records): (download)

>d3v6ea_ d.3.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqglaglrnlgntcfmnsilqclsntrelrdyclqrlymrdlhhgsnahtalveefakli
qtiwtsspndvvspsefktqiqryaprfvgynqqdaqeflrflldglhnevnrvtlrpkp
enldhlpddekgrqmwrkyleredsrigdlfvgqlkssltctdcgycstvfdpfwdlslp
iakevtlmdcmrlftkedvldgdekptccrcrgrkrcikkfsiqrfpkilvlhlkrfses
tsklttfvnfplrdldlrefasentnhavynlyavsnhsgttmgghytaycrspgtgewh
tfndssvtpmsssqvrtsdayllfyela

SCOPe Domain Coordinates for d3v6ea_:

Click to download the PDB-style file with coordinates for d3v6ea_.
(The format of our PDB-style files is described here.)

Timeline for d3v6ea_: