![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (9 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (10 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (4 PDB entries) |
![]() | Domain d3v62a_: 3v62 A: [201201] Other proteins in same PDB: d3v62b1, d3v62b2, d3v62e1, d3v62e2 automated match to d3v62d_ protein/DNA complex; complexed with neq, so4 |
PDB Entry: 3v62 (more details), 2.9 Å
SCOPe Domain Sequences for d3v62a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v62a_ d.15.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} pethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpe dldmedndiieahreqigg
Timeline for d3v62a_: