SCOP 1.57: Domain d1fj1b1: 1fj1 B:1-114

Lineage for d1fj1b1 (1fj1 B:1-114)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab LA-2 (mouse), kappa L chain [48821] (1 PDB entry)

8. Domain d1fj1b1: 1fj1 B:1-114 [20119]
   Other proteins in same PDB: d1fj1a2, d1fj1b2, d1fj1c2, d1fj1d2, d1fj1e_, d1fj1f_

Details for d1fj1b1

PDB Entry: 1fj1, 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2

SCOP Domain Sequences for d1fj1b1:

Sequence; same for both SEQRES and ATOM records:

>d1fj1b1 b.1.1.1 (B:1-114) Immunoglobulin (variable domains of L and H chains) {Fab LA-2 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgytftdysmywvkqapgkglkrmgwintetgepty
addfkgrfalsldtsastaylhisnlknedtatyfcargldswgqgtsvtvssa

Timeline for d1fj1b1:

• d1fj1b1 first appeared (with stable ids) in SCOP 1.55
  
• d1fj1b1 appears in SCOP 1.59
  
• d1fj1b1 appears in the current release, SCOPe 2.08