Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab LA-2 (mouse), kappa L chain [48821] (1 PDB entry) |
Domain d1fj1a1: 1fj1 A:1-107 [20118] Other proteins in same PDB: d1fj1a2, d1fj1b2, d1fj1c2, d1fj1d2, d1fj1e_, d1fj1f_ |
PDB Entry: 1fj1 (more details), 2.68 Å
SCOP Domain Sequences for d1fj1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fj1a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab LA-2 (mouse), kappa L chain} diqmtqspsslsatlggkvtitckasqdinkyiawyqhkpgkgprllihytstlqpgnps rfsgsgsgrdysfsisnleaediaiyyclqydnlqrtfgggtkveik
Timeline for d1fj1a1: