Lineage for d1osph1 (1osp H:1-120)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022485Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)
  8. 2022503Domain d1osph1: 1osp H:1-120 [20117]
    Other proteins in same PDB: d1osph2, d1ospl1, d1ospl2, d1ospo_
    part of Fab 184.1 against OspA

Details for d1osph1

PDB Entry: 1osp (more details), 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab
PDB Compounds: (H:) fab 184.1

SCOPe Domain Sequences for d1osph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osph1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgepitsgfwdwirkfpgnklefmgyirygggtyyn
pslkspisitrdtsknhyylqlnsvvtedtatyycarsrdyygssgfafwgegtlvtvsa

SCOPe Domain Coordinates for d1osph1:

Click to download the PDB-style file with coordinates for d1osph1.
(The format of our PDB-style files is described here.)

Timeline for d1osph1: