Lineage for d1osph1 (1osp H:1-120)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287702Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (17 PDB entries)
  8. 287713Domain d1osph1: 1osp H:1-120 [20117]
    Other proteins in same PDB: d1osph2, d1ospl1, d1ospl2, d1ospo_
    part of Fab 184.1 against OspA
    mutant

Details for d1osph1

PDB Entry: 1osp (more details), 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab

SCOP Domain Sequences for d1osph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osph1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2}
evqlqesgpslvkpsqtlsltcsvtgepitsgfwdwirkfpgnklefmgyirygggtyyn
pslkspisitrdtsknhyylqlnsvvtedtatyycarsrdyygssgfafwgegtlvtvsa

SCOP Domain Coordinates for d1osph1:

Click to download the PDB-style file with coordinates for d1osph1.
(The format of our PDB-style files is described here.)

Timeline for d1osph1: