Lineage for d1osph1 (1osp H:1-120)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157834Species Fab 184.1 (mouse), kappa L chain [48820] (1 PDB entry)
  8. 157835Domain d1osph1: 1osp H:1-120 [20117]
    Other proteins in same PDB: d1osph2, d1ospl2, d1ospo_

Details for d1osph1

PDB Entry: 1osp (more details), 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab

SCOP Domain Sequences for d1osph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osph1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab 184.1 (mouse), kappa L chain}
evqlqesgpslvkpsqtlsltcsvtgepitsgfwdwirkfpgnklefmgyirygggtyyn
pslkspisitrdtsknhyylqlnsvvtedtatyycarsrdyygssgfafwgegtlvtvsa

SCOP Domain Coordinates for d1osph1:

Click to download the PDB-style file with coordinates for d1osph1.
(The format of our PDB-style files is described here.)

Timeline for d1osph1: