SCOP 1.59: Domain d1ospl1: 1osp L:1-107

Lineage for d1ospl1 (1osp L:1-107)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab 184.1 (mouse), kappa L chain [48820] (1 PDB entry)

8. Domain d1ospl1: 1osp L:1-107 [20116]
   Other proteins in same PDB: d1osph2, d1ospl2, d1ospo_

Details for d1ospl1

PDB Entry: 1osp, 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab

SCOP Domain Sequences for d1ospl1:

Sequence; same for both SEQRES and ATOM records:

>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 184.1 (mouse), kappa L chain}
diqmsqssssfsvslgdrvtitckasediysrlawyqqkpgnaprllisgatsletwvps
rfsgsdsgkdytlsitslqtedvatyfcqqywsppptfgggtkleik

Timeline for d1ospl1:

• d1ospl1 first appeared (with stable ids) in SCOP 1.55
  
• d1ospl1 appears in SCOP 1.57
  
• d1ospl1 appears in SCOP 1.61
  
• d1ospl1 appears in the current release, SCOPe 2.08