| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein automated matches [190531] (23 species) not a true protein |
| Species Red alga (Porphyridium purpureum) [TaxId:35688] [194584] (5 PDB entries) |
| Domain d3v58d_: 3v58 D: [201159] automated match to d3v58b_ complexed with peb, so4 |
PDB Entry: 3v58 (more details), 1.85 Å
SCOPe Domain Sequences for d3v58d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v58d_ a.1.1.3 (D:) automated matches {Red alga (Porphyridium purpureum) [TaxId: 35688]}
mldafsrvvvnsdakaayvggsdlqalksfiadgnkrldavnsivsnascmvsdavsgmi
cenpglispggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial
gvptnssiravsimkaqavafitntaterkmsfaagdctslasevasyfdrvgaais
Timeline for d3v58d_: