Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein automated matches [190332] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries) |
Domain d3v4ma_: 3v4m A: [201157] automated match to d3v4mb_ complexed with cl, na |
PDB Entry: 3v4m (more details), 1.8 Å
SCOPe Domain Sequences for d3v4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4ma_ d.58.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
Timeline for d3v4ma_: