Lineage for d3v4ma_ (3v4m A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908949Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries)
  8. 1908951Domain d3v4ma_: 3v4m A: [201157]
    automated match to d3v4mb_
    complexed with cl, na

Details for d3v4ma_

PDB Entry: 3v4m (more details), 1.8 Å

PDB Description: crystal structure of a rna binding domain of a u2 small nuclear ribonucleoprotein auxiliary factor 2 (u2af) from mus musculus at 1.80 a resolution
PDB Compounds: (A:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d3v4ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v4ma_ d.58.7.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcg
kifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

SCOPe Domain Coordinates for d3v4ma_:

Click to download the PDB-style file with coordinates for d3v4ma_.
(The format of our PDB-style files is described here.)

Timeline for d3v4ma_: