![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries) |
![]() | Domain d3v4ma1: 3v4m A:372-475 [201157] Other proteins in same PDB: d3v4ma2 automated match to d3v4mb_ complexed with cl, na |
PDB Entry: 3v4m (more details), 1.8 Å
SCOPe Domain Sequences for d3v4ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v4ma1 d.58.7.1 (A:372-475) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
Timeline for d3v4ma1: