![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
![]() | Protein automated matches [190935] (24 species) not a true protein |
![]() | Species Escherichia coli [TaxId:217992] [196085] (1 PDB entry) |
![]() | Domain d3v4db1: 3v4d B:1-126 [201153] Other proteins in same PDB: d3v4db2, d3v4dc2, d3v4dd2, d3v4de2, d3v4df2 automated match to d3v4dc_ |
PDB Entry: 3v4d (more details), 1.95 Å
SCOPe Domain Sequences for d3v4db1:
Sequence, based on SEQRES records: (download)
>d3v4db1 d.79.1.0 (B:1-126) automated matches {Escherichia coli [TaxId: 217992]} mpksviipagssaplapfvpgtladgvvyvsgtlafdqhnnvlfaddpkaqtrhvletir kvietaggtmadvtfnsifitdwknyaaineiyaeffpgdkparfciqcglvkpdalvei atiahi
>d3v4db1 d.79.1.0 (B:1-126) automated matches {Escherichia coli [TaxId: 217992]} mpksviipagssaapfvpgtladgvvyvsgtlafdqhnnvlfaddpkaqtrhvletirkv ietaggtmadvtfnsifitdwknyaaineiyaeffpgdkparfciqcglvkpdalveiat iahi
Timeline for d3v4db1: