SCOPe 2.03: Domain d3v3zh2: 3v3z H:36-250

Lineage for d3v3zh2 (3v3z H:36-250)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries)
   Uniprot P11846

8. Domain d3v3zh2: 3v3z H:36-250 [201151]
   Other proteins in same PDB: d3v3zh1, d3v3zl_, d3v3zm_
   automated match to d1l9bh1
   complexed with bcl, bph, cl, dio, fe, hto, k, lda, po4, spn, u10; mutant

Details for d3v3zh2

PDB Entry: 3v3z, 2.9 Å

PDB Description: I(L177)H mutant structure of photosynthetic reaction center from Rhodobacter sphaeroides

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3v3zh2:

Sequence; same for both SEQRES and ATOM records:

>d3v3zh2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d3v3zh2:

• d3v3zh2 is new in SCOPe 2.03-stable
  
• d3v3zh2 appears in SCOPe 2.04
  
• d3v3zh2 appears in the current release, SCOPe 2.08