SCOP 1.57: Domain d1kemh1: 1kem H:1-115

Lineage for d1kemh1 (1kem H:1-115)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab 28B4 (mouse), kappa L chain [48819] (2 PDB entries)

8. Domain d1kemh1: 1kem H:1-115 [20115]
   Other proteins in same PDB: d1kemh2, d1keml2

Details for d1kemh1

PDB Entry: 1kem, 2.2 Å

PDB Description: catalytic antibody 28b4 fab fragment

SCOP Domain Sequences for d1kemh1:

Sequence; same for both SEQRES and ATOM records:

>d1kemh1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab 28B4 (mouse), kappa L chain}
evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsv

Timeline for d1kemh1:

• d1kemh1 first appeared (with stable ids) in SCOP 1.55
  
• d1kemh1 appears in SCOP 1.59
  
• d1kemh1 appears in the current release, SCOPe 2.08