Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab 28B4 (mouse), kappa L chain [48819] (2 PDB entries) |
Domain d1kemh1: 1kem H:1-115 [20115] Other proteins in same PDB: d1kemh2, d1keml2 |
PDB Entry: 1kem (more details), 2.2 Å
SCOP Domain Sequences for d1kemh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kemh1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab 28B4 (mouse), kappa L chain} evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsv
Timeline for d1kemh1: