Lineage for d1kemh1 (1kem H:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739974Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2740008Domain d1kemh1: 1kem H:1-119 [20115]
    Other proteins in same PDB: d1kemh2, d1keml1, d1keml2
    part of Fab 28B4

Details for d1kemh1

PDB Entry: 1kem (more details), 2.2 Å

PDB Description: catalytic antibody 28b4 fab fragment
PDB Compounds: (H:) 28b4 fab

SCOPe Domain Sequences for d1kemh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kemh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsvtvss

SCOPe Domain Coordinates for d1kemh1:

Click to download the PDB-style file with coordinates for d1kemh1.
(The format of our PDB-style files is described here.)

Timeline for d1kemh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kemh2