Lineage for d3v3ym_ (3v3y M:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632594Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2632595Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2632596Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2632696Protein M (medium) subunit [81481] (4 species)
  7. 2632697Species Rhodobacter sphaeroides [TaxId:1063] [81479] (64 PDB entries)
    Uniprot P02953
  8. 2632754Domain d3v3ym_: 3v3y M: [201149]
    Other proteins in same PDB: d3v3yh1, d3v3yh2, d3v3yl_
    automated match to d3v3zm_
    complexed with bcl, bph, cl, dio, fe, lda, po4, spn, u10

Details for d3v3ym_

PDB Entry: 3v3y (more details), 2.8 Å

PDB Description: Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3v3ym_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v3ym_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d3v3ym_:

Click to download the PDB-style file with coordinates for d3v3ym_.
(The format of our PDB-style files is described here.)

Timeline for d3v3ym_: