Lineage for d3v3xd1 (3v3x D:3-56)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503865Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2503866Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 protein domains)
  6. 2503891Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2503895Species Streptococcus sp. [TaxId:1320] [193546] (6 PDB entries)
  8. 2503900Domain d3v3xd1: 3v3x D:3-56 [201146]
    Other proteins in same PDB: d3v3xa2, d3v3xb2, d3v3xc2, d3v3xd2
    automated match to d3v3xc_
    complexed with 2pe, act, gol, mtn; mutant

Details for d3v3xd1

PDB Entry: 3v3x (more details), 2 Å

PDB Description: Nitroxide Spin Labels in Protein GB1: N8/K28 Double Mutant
PDB Compounds: (D:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d3v3xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v3xd1 d.15.7.1 (D:3-56) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp. [TaxId: 1320]}
yklilcgktlkgettteavdaataecvfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d3v3xd1:

Click to download the PDB-style file with coordinates for d3v3xd1.
(The format of our PDB-style files is described here.)

Timeline for d3v3xd1: