SCOPe 2.08: Domain d3uzvb2: 3uzv B:133-244

Lineage for d3uzvb2 (3uzv B:133-244)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3uzvb2: 3uzv B:133-244 [201137]
   Other proteins in same PDB: d3uzva_
   automated match to d1nqba2
   complexed with eoh

Details for d3uzvb2

PDB Entry: 3uzv, 2.1 Å

PDB Description: Crystal structure of the dengue virus serotype 2 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (B:) anti-dengue Mab 4E11

SCOPe Domain Sequences for d3uzvb2:

Sequence; same for both SEQRES and ATOM records:

>d3uzvb2 b.1.1.0 (B:133-244) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtpaslavslgqratiscrasenvdrygnsfmhwyqqkagqppklliyrasnles
giparfsgsgsrtdftltinpveaddvatyfcqrsnevpwtfgggtkleikr

Timeline for d3uzvb2:

• d3uzvb2 first appeared in SCOPe 2.03
  
• d3uzvb2 appears in SCOPe 2.07