SCOPe 2.07: Domain d3uzvb1: 3uzv B:2-117

Lineage for d3uzvb1 (3uzv B:2-117)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3uzvb1: 3uzv B:2-117 [201136]
   Other proteins in same PDB: d3uzva_
   automated match to d1nqba1
   complexed with eoh

Details for d3uzvb1

PDB Entry: 3uzv, 2.1 Å

PDB Description: Crystal structure of the dengue virus serotype 2 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (B:) anti-dengue Mab 4E11

SCOPe Domain Sequences for d3uzvb1:

Sequence; same for both SEQRES and ATOM records:

>d3uzvb1 b.1.1.0 (B:2-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vklleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtky
dpkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsa

Timeline for d3uzvb1:

• d3uzvb1 first appeared in SCOPe 2.03
  
• d3uzvb1 appears in SCOPe 2.06
  
• d3uzvb1 appears in the current release, SCOPe 2.08