SCOPe 2.08: Domain d3uzqa1: 3uzq A:3-117

Lineage for d3uzqa1 (3uzq A:3-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3uzqa1: 3uzq A:3-117 [201134]
   Other proteins in same PDB: d3uzqa3, d3uzqb_
   automated match to d1nqba1
   complexed with edo, gol, mes

Details for d3uzqa1

PDB Entry: 3uzq, 1.6 Å

PDB Description: Crystal structure of the dengue virus serotype 1 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (A:) anti-dengue Mab 4E11

SCOPe Domain Sequences for d3uzqa1:

Sequence; same for both SEQRES and ATOM records:

>d3uzqa1 b.1.1.0 (A:3-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
klleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtkyd
pkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsa

Timeline for d3uzqa1:

• d3uzqa1 first appeared in SCOPe 2.03
  
• d3uzqa1 appears in SCOPe 2.07