Lineage for d3uypa1 (3uyp A:2-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2369871Domain d3uypa1: 3uyp A:2-117 [201132]
    Other proteins in same PDB: d3uypb_
    automated match to d1nqba1
    complexed with gol, so4, trs

Details for d3uypa1

PDB Entry: 3uyp (more details), 2 Å

PDB Description: Crystal structure of the dengue virus serotype 4 envelope protein domain III in complex with the variable domains of Mab 4E11
PDB Compounds: (A:) anti-dengue Mab 4E11

SCOPe Domain Sequences for d3uypa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uypa1 b.1.1.0 (A:2-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vklleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtky
dpkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsa

SCOPe Domain Coordinates for d3uypa1:

Click to download the PDB-style file with coordinates for d3uypa1.
(The format of our PDB-style files is described here.)

Timeline for d3uypa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3uypa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3uypb_