| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (23 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
| Domain d3uypa1: 3uyp A:2-117 [201132] Other proteins in same PDB: d3uypb_ automated match to d1nqba1 complexed with gol, so4, trs |
PDB Entry: 3uyp (more details), 2 Å
SCOPe Domain Sequences for d3uypa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uypa1 b.1.1.0 (A:2-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vklleqsgaelvkpgasvrlsctasgfnikdtymswvkqrpeqglewigridpangdtky
dpkfqgkatitadtssntaylhlssltsgdtavyycsrgwegfaywgqgtlvtvsa
Timeline for d3uypa1: