SCOP 1.59: Domain d1kelh1: 1kel H:1-115

Lineage for d1kelh1 (1kel H:1-115)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab 28B4 (mouse), kappa L chain [48819] (2 PDB entries)

8. Domain d1kelh1: 1kel H:1-115 [20113]
   Other proteins in same PDB: d1kelh2, d1kell2

Details for d1kelh1

PDB Entry: 1kel, 1.9 Å

PDB Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)

SCOP Domain Sequences for d1kelh1:

Sequence; same for both SEQRES and ATOM records:

>d1kelh1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab 28B4 (mouse), kappa L chain}
evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsv

Timeline for d1kelh1:

• d1kelh1 first appeared (with stable ids) in SCOP 1.55
  
• d1kelh1 appears in SCOP 1.57
  
• d1kelh1 appears in SCOP 1.61
  
• d1kelh1 appears in the current release, SCOPe 2.08