Lineage for d1kelh1 (1kel H:1-115)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 protein domains)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7387Species Fab 28B4 (mouse), kappa L chain [48819] (2 PDB entries)
  8. 7388Domain d1kelh1: 1kel H:1-115 [20113]
    Other proteins in same PDB: d1kelh2, d1kell2

Details for d1kelh1

PDB Entry: 1kel (more details), 1.9 Å

PDB Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)

SCOP Domain Sequences for d1kelh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kelh1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab 28B4 (mouse), kappa L chain}
evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsv

SCOP Domain Coordinates for d1kelh1:

Click to download the PDB-style file with coordinates for d1kelh1.
(The format of our PDB-style files is described here.)

Timeline for d1kelh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kelh2