Lineage for d3ux7g_ (3ux7 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733508Species Vipera ammodytes [TaxId:73841] [195494] (1 PDB entry)
  8. 2733515Domain d3ux7g_: 3ux7 G: [201129]
    automated match to d3ux7c_
    complexed with so4

Details for d3ux7g_

PDB Entry: 3ux7 (more details), 2.97 Å

PDB Description: Crystal structure of a dimeric myotoxic component of the Vipera ammodytes meridionalis venom reveals determinants of myotoxicity and membrane damaging activity
PDB Compounds: (G:) Ammodytin L(1) isoform

SCOPe Domain Sequences for d3ux7g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ux7g_ a.133.1.2 (G:) automated matches {Vipera ammodytes [TaxId: 73841]}
sviefgkmiqeetdknpltsysfygchcglgnggkpkdatdrccfvhsccyaslsdcspa
tnrysyhkeggaivcgsstpckgqicecdkaaaicfkenlktynkkykvylrfkckgvse
kc

SCOPe Domain Coordinates for d3ux7g_:

Click to download the PDB-style file with coordinates for d3ux7g_.
(The format of our PDB-style files is described here.)

Timeline for d3ux7g_: