![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
![]() | Protein automated matches [190139] (27 species) not a true protein |
![]() | Species Vipera ammodytes [TaxId:73841] [195494] (1 PDB entry) |
![]() | Domain d3ux7e_: 3ux7 E: [201127] automated match to d3ux7c_ complexed with so4 |
PDB Entry: 3ux7 (more details), 2.97 Å
SCOPe Domain Sequences for d3ux7e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ux7e_ a.133.1.2 (E:) automated matches {Vipera ammodytes [TaxId: 73841]} sviefgkmiqeetdknpltsysfygchcglgnggkpkdatdrccfvhsccyaslsdcspa tnrysyhkeggaivcgsstpckgqicecdkaaaicfkenlktynkkykvylrfkckgvse kc
Timeline for d3ux7e_: