Class a: All alpha proteins [46456] (286 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein automated matches [190139] (25 species) not a true protein |
Species Vipera ammodytes [TaxId:73841] [195494] (1 PDB entry) |
Domain d3ux7d_: 3ux7 D: [201126] automated match to d3ux7c_ complexed with so4 |
PDB Entry: 3ux7 (more details), 2.97 Å
SCOPe Domain Sequences for d3ux7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ux7d_ a.133.1.2 (D:) automated matches {Vipera ammodytes [TaxId: 73841]} sviefgkmiqeetdknpltsysfygchcglgnggkpkdatdrccfvhsccyaslsdcspa tnrysyhkeggaivcgsstpckgqicecdkaaaicfkenlktynkkykvylrfkckgvse kc
Timeline for d3ux7d_: