Lineage for d3ux7b_ (3ux7 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1282888Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1282889Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1282894Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1283246Protein automated matches [190139] (24 species)
    not a true protein
  7. 1283378Species Vipera ammodytes [TaxId:73841] [195494] (1 PDB entry)
  8. 1283380Domain d3ux7b_: 3ux7 B: [201125]
    automated match to d3ux7c_
    complexed with so4

Details for d3ux7b_

PDB Entry: 3ux7 (more details), 2.97 Å

PDB Description: Crystal structure of a dimeric myotoxic component of the Vipera ammodytes meridionalis venom reveals determinants of myotoxicity and membrane damaging activity
PDB Compounds: (B:) Ammodytin L(1) isoform

SCOPe Domain Sequences for d3ux7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ux7b_ a.133.1.2 (B:) automated matches {Vipera ammodytes [TaxId: 73841]}
sviefgkmiqeetdknpltsysfygchcglgnggkpkdatdrccfvhsccyaslsdcspa
tnrysyhkeggaivcgsstpckgqicecdkaaaicfkenlktynkkykvylrfkckgvse
kc

SCOPe Domain Coordinates for d3ux7b_:

Click to download the PDB-style file with coordinates for d3ux7b_.
(The format of our PDB-style files is described here.)

Timeline for d3ux7b_: