Lineage for d3ux7a_ (3ux7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015999Protein automated matches [190139] (26 species)
    not a true protein
  7. 2016158Species Vipera ammodytes [TaxId:73841] [195494] (1 PDB entry)
  8. 2016159Domain d3ux7a_: 3ux7 A: [201124]
    automated match to d3ux7c_
    complexed with so4

Details for d3ux7a_

PDB Entry: 3ux7 (more details), 2.97 Å

PDB Description: Crystal structure of a dimeric myotoxic component of the Vipera ammodytes meridionalis venom reveals determinants of myotoxicity and membrane damaging activity
PDB Compounds: (A:) Ammodytin L(1) isoform

SCOPe Domain Sequences for d3ux7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ux7a_ a.133.1.2 (A:) automated matches {Vipera ammodytes [TaxId: 73841]}
sviefgkmiqeetdknpltsysfygchcglgnggkpkdatdrccfvhsccyaslsdcspa
tnrysyhkeggaivcgsstpckgqicecdkaaaicfkenlktynkkykvylrfkckgvse
kc

SCOPe Domain Coordinates for d3ux7a_:

Click to download the PDB-style file with coordinates for d3ux7a_.
(The format of our PDB-style files is described here.)

Timeline for d3ux7a_: