SCOPe 2.06: Domain d3uwvb1: 3uwv B:1-253

Lineage for d3uwvb1 (3uwv B:1-253)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Staphylococcus aureus [TaxId:282458] [189897] (6 PDB entries)

8. Domain d3uwvb1: 3uwv B:1-253 [201122]
   Other proteins in same PDB: d3uwva2, d3uwvb2
   automated match to d3uwva_
   complexed with 2pg, na

Details for d3uwvb1

PDB Entry: 3uwv, 2.07 Å

PDB Description: Crystal structure of Staphylococcus Aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d3uwvb1:

Sequence; same for both SEQRES and ATOM records:

>d3uwvb1 c.1.1.1 (B:1-253) Triosephosphate isomerase {Staphylococcus aureus [TaxId: 282458]}
mrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaqg
leigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaifk
hgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgkss
tsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggasl
kvedfvqllegak

Timeline for d3uwvb1:

• d3uwvb1 first appeared in SCOPe 2.03, called d3uwvb_
  
• d3uwvb1 was called d3uwvb_ in SCOPe 2.05
  
• d3uwvb1 appears in SCOPe 2.07
  
• d3uwvb1 appears in the current release, SCOPe 2.08