SCOPe 2.04: Domain d3uwvb_: 3uwv B:

Lineage for d3uwvb_ (3uwv B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families)

5. Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
   automatically mapped to Pfam PF00121

6. Protein Triosephosphate isomerase [51353] (20 species)

7. Species Staphylococcus aureus [TaxId:282458] [189897] (6 PDB entries)

8. Domain d3uwvb_: 3uwv B: [201122]
   automated match to d3uwva_
   complexed with 2pg, na

Details for d3uwvb_

PDB Entry: 3uwv, 2.07 Å

PDB Description: Crystal structure of Staphylococcus Aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid

PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d3uwvb_:

Sequence; same for both SEQRES and ATOM records:

>d3uwvb_ c.1.1.1 (B:) Triosephosphate isomerase {Staphylococcus aureus [TaxId: 282458]}
smrtpiiagnwkmnktvqeakdfvnalptlpdskevesvicapaiqldalttavkegkaq
gleigaqntyfedngaftgetspvaladlgvkyvvighserrelfhetdeeinkkahaif
khgmtpiicvgetdeeresgkandvvgeqvkkavaglsedqlksvviayepiwaigtgks
stsedanemcafvrqtiadlsskevseatriqyggsvkpnnikeymaqtdidgalvggas
lkvedfvqllegak

Timeline for d3uwvb_:

• d3uwvb_ first appeared in SCOPe 2.03
  
• d3uwvb_ appears in SCOPe 2.05
  
• d3uwvb_ appears in the current release, SCOPe 2.08, called d3uwvb1