SCOPe 2.03: Domain d1kell1: 1kel L:1-112

Lineage for d1kell1 (1kel L:1-112)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (131 PDB entries)
   Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10

8. Domain d1kell1: 1kel L:1-112 [20112]
   Other proteins in same PDB: d1kelh1, d1kelh2, d1kell2
   part of Fab 28B4
   complexed with aah

Details for d1kell1

PDB Entry: 1kel, 1.9 Å

PDB Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)

PDB Compounds: (L:) 28b4 fab

SCOPe Domain Sequences for d1kell1:

Sequence; same for both SEQRES and ATOM records:

>d1kell1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrfsqsivhsngntylewylqksgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvprtfgggtkleik

Timeline for d1kell1:

• d1kell1 first appeared (with stable ids) in SCOP 1.55
  
• d1kell1 appears in SCOPe 2.02
  
• d1kell1 appears in SCOPe 2.04
  
• d1kell1 appears in the current release, SCOPe 2.08